GLP-3 Analogue — Research Grade
Referenced in research on incretin receptor pharmacology.
For research use only. Not for human consumption. Synthetic GLP analogue peptide supplied as lyophilised powder. Peptide sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (research analogue). Molecular weight: ~4113 g/mol. Purity: ≥99% (HPLC). Presentation: net peptide content by vial size (see variants). Storage: store lyophilised powder at -20°C, protected from light. Reconstitution: reconstitute with bacteriostatic water; store reconstituted solution at 2–8°C. Lot #G3-2026-02-04. Certificate of Analysis (COA) available.
For research use only. Not for human consumption.
Characterised, lot-tracked, COA-verified
Every batch is HPLC-checked and matched against the reference standard before it leaves the lab. The lot number and purity figure on this page are the actual values for the lot you will receive — not a brand-wide claim.
Storage & reconstitution
Store the lyophilised vial at −20°C, protected from light. Reconstitute with bacteriostatic water in the volume listed on the COA; store reconstituted solution at 2–8°C and follow the lot-specific use-by note.
Specs
- Purity
- ≥99% HPLC
- Sequence
- HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
- Lot number
- G3-2026-02-04
